Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens hemoglobin subunit gamma 1 (HBG1) (NM_000559). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P69891 |
| Entry Name | HBG1_HUMAN |
| Gene Names | HBG1 PRO2979 |
| Alternative Gene Names | |
| Alternative Protein Names | Hemoglobin subunit gamma-1 (Gamma-1-globin) (Hb F Agamma) (Hemoglobin gamma-1 chain) (Hemoglobin gamma-A chain) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 147 |
| Molecular Weight(Da) | 16140 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH |
Background
| Function | FUNCTION: Gamma chains make up the fetal hemoglobin F, in combination with alpha chains. |
| Pathway | |
| Protein Families | Globin family |
| Tissue Specificity | Red blood cells. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |